DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and ATFP8

DIOPT Version :10

Sequence 1:NP_524472.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_187779.1 Gene:ATFP8 / 820345 AraportID:AT3G11730 Length:205 Species:Arabidopsis thaliana


Alignment Length:209 Identity:72/209 - (34%)
Similarity:115/209 - (55%) Gaps:23/209 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTA 65
            ||.....|.|::::|||||||:.|:.::.:..:.:.|.:|||.||..:.:..:.:.:.:||||||
plant     1 MSNEYDYLFKLLLIGDSSVGKSCLLLRFADDAYIDSYISTIGVDFKIRTIEQDGKTIKLQIWDTA 65

  Fly    66 GQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL- 129
            |||||:::..::||||...::|||.|...||.|:..|..|....|:    :....:::|||.|: 
plant    66 GQERFRTITSSYYRGAHGIIIVYDCTEMESFNNVKQWLSEIDRYAN----ESVCKLLIGNKNDMV 126

  Fly   130 DNRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGS 194
            :::.|||...:....... ||:.|||||:.||||.||..||.   |::.:            :||
plant   127 ESKVVSTETGRALADELG-IPFLETSAKDSINVEQAFLTIAG---EIKKK------------MGS 175

  Fly   195 QN--NRPGNPDNCQ 206
            |.  |:...|...|
plant   176 QTNANKTSGPGTVQ 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_524472.1 Rab7 9..179 CDD:206655 63/170 (37%)
ATFP8NP_187779.1 Rab1_Ypt1 7..172 CDD:206661 64/172 (37%)

Return to query results.
Submit another query.