DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and RAB6A

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_181989.1 Gene:RAB6A / 819069 AraportID:AT2G44610 Length:208 Species:Arabidopsis thaliana


Alignment Length:203 Identity:78/203 - (38%)
Similarity:112/203 - (55%) Gaps:10/203 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLG 74
            |::.|||.||||||::.:::..:|.|.|:||||.||.:|.:.:.||.|.:|:|||||||||:||.
plant    11 KLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLI 75

  Fly    75 VAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL-DNRQVSTRR 138
            .::.|.:...|:||||.:..||.|...|.||.   .:.|..|.. .|::|||.|| |.||||...
plant    76 PSYIRDSSVAVIVYDVASRQSFLNTTKWIDEV---RTERGSDVI-VVLVGNKTDLVDKRQVSIEE 136

  Fly   139 AQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQNNRPG--- 200
            |:...:..| :.:.|||||.|.|::..|:.||.....:|..:....:....:.|.|.|....   
plant   137 AEAKARELN-VMFIETSAKAGFNIKALFRKIAAALPGMETLSSTKQEDMVDVNLKSSNANASLAQ 200

  Fly   201 -NPDNCQC 207
             ....|.|
plant   201 QQSGGCSC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 73/169 (43%)
RAB 9..174 CDD:197555 72/164 (44%)
RAB6ANP_181989.1 Rab6 10..170 CDD:206654 72/163 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.