DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and Rab11a

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_112414.1 Gene:Rab11a / 81830 RGDID:619762 Length:216 Species:Rattus norvegicus


Alignment Length:176 Identity:63/176 - (35%)
Similarity:109/176 - (61%) Gaps:6/176 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQS 72
            |.||:::|||.|||::|::::....|:.:.|:|||.:|.|:.:.|:.:.:..||||||||||:::
  Rat    11 LFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRA 75

  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVST 136
            :..|:||||...:||||:....:::|::.|..|....|.    .:...:::|||.||.: |.|.|
  Rat    76 ITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHAD----SNIVIMLVGNKSDLRHLRAVPT 136

  Fly   137 RRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEV 182
            ..|:.:.: ||.:.:.||||.:..|||.|||.|......:.::.::
  Rat   137 DEARAFAE-KNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQM 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 62/170 (36%)
RAB 9..174 CDD:197555 62/165 (38%)
Rab11aNP_112414.1 Rab11_like 9..173 CDD:206660 63/166 (38%)
Effector region. /evidence=ECO:0000255 40..48 4/7 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 183..211
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.