DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and ArRABA1h

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_180943.4 Gene:ArRABA1h / 817957 AraportID:AT2G33870 Length:218 Species:Arabidopsis thaliana


Alignment Length:203 Identity:74/203 - (36%)
Similarity:121/203 - (59%) Gaps:22/203 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQS 72
            |.||::.|||.|||::|::::....||:..::|||.:|.|:.:.|:|::|..||||||||||:::
plant    13 LFKVVLTGDSGVGKSNLLSRFTRNDFSHDSRSTIGVEFATRSIQVDDKIVKAQIWDTAGQERYRA 77

  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFP----FVVLGNKVDLDN-R 132
            :..|:||||...:||||||...:|:|::.|..|.        .||..    .:::|||.||:: |
plant    78 ITSAYYRGAVGALLVYDVTRHVTFENVERWLKEL--------RDHTDANTVIMLVGNKADLNHLR 134

  Fly   133 QVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAF--------QVIAKNALELEAEAEVINDFPDQ 189
            .:||...:.:.:.:|.. :.||||.|.||||.||        :|::|.||:...:..........
plant   135 AISTEEVKDFAERENTF-FMETSALEAINVENAFTEVLTQIYRVVSKKALDAGDDPTTALPKGQM 198

  Fly   190 ITLGSQNN 197
            |.:||:::
plant   199 INVGSRDD 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 70/182 (38%)
RAB 9..174 CDD:197555 68/177 (38%)
ArRABA1hNP_180943.4 Rab11_like 11..175 CDD:206660 67/170 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.