DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and RAB7A

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_565521.1 Gene:RAB7A / 816724 AraportID:AT2G21880 Length:212 Species:Arabidopsis thaliana


Alignment Length:213 Identity:119/213 - (55%)
Similarity:151/213 - (70%) Gaps:14/213 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQE 68
            :.::|||||:||||.|||||||||||.|:|:.||||||||||.|||:.::::.||:|||||||||
plant     5 KNRTLLKVIVLGDSGVGKTSLMNQYVYKKFNKQYKATIGADFVTKELHIDEKSVTLQIWDTAGQE 69

  Fly    69 RFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLD--- 130
            ||||||.|||||||||||||||....||:.|::|..|||.||:|.:|:.||||::|||.|:|   
plant    70 RFQSLGAAFYRGADCCVLVYDVNNLKSFETLNNWHTEFLKQANPMEPETFPFVLIGNKTDVDGGN 134

  Fly   131 NRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVIND------FPDQ 189
            :|.||.:||.:||.||.:|||:||||||..|::.||..:|..||..|.:..  ||      :.|.
plant   135 SRVVSNKRAIEWCGSKGNIPYHETSAKEDTNIDEAFLSVAHIALSNERKQS--NDIYPRGQYHDS 197

  Fly   190 ITLGSQNNRPGNPDNCQC 207
            :|   ....|.....|.|
plant   198 VT---DIIDPDQSRGCAC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 111/172 (65%)
RAB 9..174 CDD:197555 108/167 (65%)
RAB7ANP_565521.1 Rab7 10..181 CDD:206655 110/170 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 259 1.000 Domainoid score I489
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172019at2759
OrthoFinder 1 1.000 - - FOG0001661
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47981
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1058
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.