DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and RAB7A

DIOPT Version :10

Sequence 1:NP_524472.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_565521.1 Gene:RAB7A / 816724 AraportID:AT2G21880 Length:212 Species:Arabidopsis thaliana


Alignment Length:213 Identity:119/213 - (55%)
Similarity:151/213 - (70%) Gaps:14/213 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQE 68
            :.::|||||:||||.|||||||||||.|:|:.||||||||||.|||:.::::.||:|||||||||
plant     5 KNRTLLKVIVLGDSGVGKTSLMNQYVYKKFNKQYKATIGADFVTKELHIDEKSVTLQIWDTAGQE 69

  Fly    69 RFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLD--- 130
            ||||||.|||||||||||||||....||:.|::|..|||.||:|.:|:.||||::|||.|:|   
plant    70 RFQSLGAAFYRGADCCVLVYDVNNLKSFETLNNWHTEFLKQANPMEPETFPFVLIGNKTDVDGGN 134

  Fly   131 NRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVIND------FPDQ 189
            :|.||.:||.:||.||.:|||:||||||..|::.||..:|..||..|.:..  ||      :.|.
plant   135 SRVVSNKRAIEWCGSKGNIPYHETSAKEDTNIDEAFLSVAHIALSNERKQS--NDIYPRGQYHDS 197

  Fly   190 ITLGSQNNRPGNPDNCQC 207
            :|   ....|.....|.|
plant   198 VT---DIIDPDQSRGCAC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_524472.1 Rab7 9..179 CDD:206655 111/172 (65%)
RAB7ANP_565521.1 Rab7 10..181 CDD:206655 110/170 (65%)

Return to query results.
Submit another query.