DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and Rab27b

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001076022.1 Gene:Rab27b / 80718 MGIID:1931295 Length:218 Species:Mus musculus


Alignment Length:214 Identity:75/214 - (35%)
Similarity:119/214 - (55%) Gaps:18/214 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDR----------VVTMQIW 62
            |:|::.||||.||||:.:.:|.:.:|:.::..|:|.||..|.||.:.:          .|.:|:|
Mouse     9 LIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDTQGADGASGKAFKVHLQLW 73

  Fly    63 DTAGQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKV 127
            ||||||||:||..||:|.|...:|::|:|:..||.|:.:|..:....|...:||   .|::|||.
Mouse    74 DTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPD---IVLIGNKA 135

  Fly   128 DL-DNRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQIT 191
            || |.|:|:.|:|::..: |..|||:||||..|.|||.:.:.:....::...:.......||.:.
Mouse   136 DLPDQREVNERQARELAE-KYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCVEKTQVPDTVN 199

  Fly   192 LGSQNNRPGN---PDNCQC 207
            .|:.....|.   ...|.|
Mouse   200 GGNSGKLDGEKPAEKKCAC 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 68/180 (38%)
RAB 9..174 CDD:197555 68/175 (39%)
Rab27bNP_001076022.1 Rab27A 6..185 CDD:206700 69/179 (39%)
RAB 10..184 CDD:197555 68/177 (38%)
Effector region. /evidence=ECO:0000250 38..46 2/7 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..218 5/23 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.