DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and rab33a

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001072527.1 Gene:rab33a / 779982 XenbaseID:XB-GENE-494412 Length:215 Species:Xenopus tropicalis


Alignment Length:215 Identity:76/215 - (35%)
Similarity:112/215 - (52%) Gaps:31/215 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQ- 71
            :.|:|::|||:||||.|..::....|....:||||.||..|.|.::...:.:|:|||||||||: 
 Frog    17 IFKIIVIGDSNVGKTCLTFRFCGGGFPGSSEATIGVDFREKTVEIDGEKIKVQVWDTAGQERFRH 81

  Fly    72 SLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVD-LDNRQVS 135
            ||...:||.....|.|||||..:||.||.:|..|....|.|.   ..|.|::|||.| |:..:|.
 Frog    82 SLVEHYYRNVHGVVFVYDVTKLSSFHNLRTWLQECEGHAVPA---LVPRVLVGNKCDLLEQVEVP 143

  Fly   136 TRRAQQWCQSKNDIPYYETSAK---EGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQNN 197
            :..|..:.:: :.:..:|||||   :..|||..|..:   |.:|:|:    ...|.:   ||  |
 Frog   144 SGLALNFAKA-HKMVLFETSAKDPSQAKNVEKIFMSL---ACQLKAQ----KSLPYR---GS--N 195

  Fly   198 RPGNPDN----------CQC 207
            ||.:.:.          |.|
 Frog   196 RPHSSNEREVAGVAKNICPC 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 67/174 (39%)
RAB 9..174 CDD:197555 65/169 (38%)
rab33aNP_001072527.1 Rab33B_Rab33A 16..185 CDD:133315 67/174 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.