DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and 1700009N14Rik

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001074564.1 Gene:1700009N14Rik / 75471 MGIID:1922721 Length:216 Species:Mus musculus


Alignment Length:186 Identity:52/186 - (27%)
Similarity:95/186 - (51%) Gaps:17/186 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLG 74
            |::::||...|||:.:.:::...|..:|.||:|.:........:...:...:|||||||:|..|.
Mouse    12 KLVLVGDGGTGKTAFVKRHLTGEFEKKYVATLGVEVHPLMFHTSRGPIKFNVWDTAGQEKFGGLR 76

  Fly    75 VAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDNRQVSTRRA 139
            ..:|..|...::::|||:..::||:.:|..:.:     |..::.|.|:.|||||:.:|:|..:..
Mouse    77 DGYYIQAQGAIIMFDVTSRITYKNVPNWHRDLV-----RVCENIPIVLCGNKVDVKDRKVKAKSI 136

  Fly   140 QQWCQSKNDIPYYETSAKEGINVEMAFQVIAKN----------ALELEAEAEVIND 185
            .  ...|.::.||:.|||...|.|..|..:::.          |:...|..||:.|
Mouse   137 V--FHRKKNLQYYDISAKSNYNFEKPFLWLSRRLTGDSNLEFVAMPALAPPEVVMD 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 48/178 (27%)
RAB 9..174 CDD:197555 47/173 (27%)
1700009N14RikNP_001074564.1 PTZ00132 1..216 CDD:240284 52/186 (28%)
Ran 11..176 CDD:206643 47/170 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.