DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and rab9a

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001229903.1 Gene:rab9a / 751756 ZFINID:ZDB-GENE-060825-293 Length:201 Species:Danio rerio


Alignment Length:202 Identity:98/202 - (48%)
Similarity:131/202 - (64%) Gaps:6/202 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQER 69
            |.||||||:|||..|||:||||:||..:|......|||.:|..|::.|:.|.||:||||||||||
Zfish     4 KSSLLKVILLGDGGVGKSSLMNRYVTNKFDAHLFHTIGVEFLNKDLEVDGRTVTLQIWDTAGQER 68

  Fly    70 FQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDNRQV 134
            |:||...||||:|||:|.:.|....||.||.:|:.||:..|..::|:.|||||||||:|:..|||
Zfish    69 FRSLRTPFYRGSDCCLLTFSVDDSQSFHNLVNWKKEFIYYADVKEPESFPFVVLGNKLDVSERQV 133

  Fly   135 STRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFP-DQITLGSQNNR 198
            |:..||:||......||:|||||:..||.:||:...:..|.||...|.:  .| |.:.|   :.:
Zfish   134 SSEEAQEWCMESGGYPYFETSAKDATNVAVAFEEAVRRVLSLEDRHEHL--IPTDTVNL---HRK 193

  Fly   199 PGNPDNC 205
            |.:...|
Zfish   194 PRSATQC 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 89/169 (53%)
RAB 9..174 CDD:197555 86/164 (52%)
rab9aNP_001229903.1 Rab9 4..172 CDD:206697 89/167 (53%)
RAB 8..175 CDD:197555 87/166 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172019at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.