powered by:
Protein Alignment Rab7 and Rabl2
DIOPT Version :9
Sequence 1: | NP_001247276.1 |
Gene: | Rab7 / 42841 |
FlyBaseID: | FBgn0015795 |
Length: | 207 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_030104587.1 |
Gene: | Rabl2 / 68708 |
MGIID: | 1915958 |
Length: | 227 |
Species: | Mus musculus |
Alignment Length: | 52 |
Identity: | 17/52 - (32%) |
Similarity: | 24/52 - (46%) |
Gaps: | 5/52 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 146 KNDIPYYETSAKEGINVEMAFQVIAKNALELE-AEAEVINDFPDQITLGSQN 196
|..:|.|..||.:|.||...| .:|:.|. |..|...||.|::....:|
Mouse 155 KFSLPLYFVSAADGTNVVKLF----NDAIRLAVAYKESSQDFMDEVLQELEN 202
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.