DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and Rabl2

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_030104587.1 Gene:Rabl2 / 68708 MGIID:1915958 Length:227 Species:Mus musculus


Alignment Length:52 Identity:17/52 - (32%)
Similarity:24/52 - (46%) Gaps:5/52 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KNDIPYYETSAKEGINVEMAFQVIAKNALELE-AEAEVINDFPDQITLGSQN 196
            |..:|.|..||.:|.||...|    .:|:.|. |..|...||.|::....:|
Mouse   155 KFSLPLYFVSAADGTNVVKLF----NDAIRLAVAYKESSQDFMDEVLQELEN 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 11/33 (33%)
RAB 9..174 CDD:197555 9/27 (33%)
Rabl2XP_030104587.1 P-loop_NTPase <141..186 CDD:393306 12/34 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.