DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and rab28

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001025601.1 Gene:rab28 / 594989 XenbaseID:XB-GENE-478294 Length:221 Species:Xenopus tropicalis


Alignment Length:209 Identity:69/209 - (33%)
Similarity:112/209 - (53%) Gaps:24/209 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRV-VTMQIWDTAGQERFQS 72
            :|::||||.:.|||||..::..:.|..|||.|:|.||..|.:.:...: ||:|:.|..||.....
 Frog    13 IKIVILGDGACGKTSLAMRFAQESFGKQYKQTVGIDFFLKRITLPGNLNVTLQVLDIGGQTIGGK 77

  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVL-GNKVDLDN-RQVS 135
            :...:..|....:||||:|...||:||:.|..  :::....:.:..|||.| |||:||:: |.|.
 Frog    78 MLDKYIYGTQGVLLVYDITNYQSFENLEDWFS--MVKKVNDESETQPFVALVGNKIDLEHMRTVK 140

  Fly   136 TRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAK-------NALELE-----AEAEVINDFPD 188
            ..:.|::|| :|::..|..|||.|.:|.:.||.:|.       |..|:|     .:|:::|...:
 Frog   141 ADKHQRFCQ-ENNLGSYFVSAKTGDSVFLCFQRVAAEILGIKLNKAEIEQSQRVVKADIVNYSQE 204

  Fly   189 QITLGSQNNRPGNP 202
            .:|      |..||
 Frog   205 PVT------RMVNP 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 63/184 (34%)
RAB 9..174 CDD:197555 61/174 (35%)
rab28NP_001025601.1 Rab28 13..221 CDD:206694 69/209 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.