DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and RAB5B

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001238965.1 Gene:RAB5B / 5869 HGNCID:9784 Length:215 Species:Homo sapiens


Alignment Length:171 Identity:69/171 - (40%)
Similarity:99/171 - (57%) Gaps:6/171 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLG 74
            |:::||:|:|||:||:.::|..:|....::||||.|.|:.|.::|..|..:|||||||||:.||.
Human    22 KLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLA 86

  Fly    75 VAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVSTRR 138
            ..:||||...::|||:|...:|....:|..|...||||    .....:.|||.||.| |.|....
Human    87 PMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASP----SIVIALAGNKADLANKRMVEYEE 147

  Fly   139 AQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAE 179
            ||.:... |.:.:.|||||..:||...|..|||...:.|.:
Human   148 AQAYADD-NSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQ 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 69/169 (41%)
RAB 9..174 CDD:197555 68/164 (41%)
RAB5BNP_001238965.1 Rab5_related 20..182 CDD:206653 68/164 (41%)
Effector region. /evidence=ECO:0000255 49..57 4/7 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..215 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.