Sequence 1: | NP_001247276.1 | Gene: | Rab7 / 42841 | FlyBaseID: | FBgn0015795 | Length: | 207 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004153.2 | Gene: | RAB5A / 5868 | HGNCID: | 9783 | Length: | 215 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 78/207 - (37%) |
---|---|---|---|
Similarity: | 111/207 - (53%) | Gaps: | 9/207 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 SGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAG 66
Fly 67 QERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN 131
Fly 132 -RQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQ 195
Fly 196 NNRPGNPDNCQC 207 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab7 | NP_001247276.1 | Rab7 | 9..179 | CDD:206655 | 70/170 (41%) |
RAB | 9..174 | CDD:197555 | 69/165 (42%) | ||
RAB5A | NP_004153.2 | Rab5_related | 20..182 | CDD:206653 | 69/166 (42%) |
Effector region. /evidence=ECO:0000255 | 49..57 | 4/7 (57%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 181..215 | 7/35 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |