DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and rabl6a

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_005171795.1 Gene:rabl6a / 572091 ZFINID:ZDB-GENE-030131-6174 Length:748 Species:Danio rerio


Alignment Length:231 Identity:48/231 - (20%)
Similarity:95/231 - (41%) Gaps:70/231 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVV---------NDRVVTMQIWDT 64
            :|::|.||.:.||::|.::...|:|..:|       ..|:|:.|         .|.||.:::||.
Zfish    44 MKIVIRGDRNSGKSALWHRLQGKKFLEEY-------IPTQEIQVTSIHWNYKTTDDVVKVEVWDV 101

  Fly    65 A-----GQERFQSLGVA------------------FYRGADCCVLVYDVTAPNSFKNLDSWRDEF 106
            .     |:.|.::|.:.                  .|:..:..::::|:|        ..|...:
Zfish   102 VDKAGKGKRRGENLKLENEPQESETEMALDAEFLDVYKNCNGVIMMFDIT--------KQWTFNY 158

  Fly   107 LIQASPRDPDHFPFVVLGNKVDL-DNRQVSTRRAQQWCQSKNDIP------YYETSAKEGINV-- 162
            :::..|:.|.|.|..||||:.|: ::|.:.....:.:..|.|..|      |.|:|.|.|..:  
Zfish   159 ILRELPKVPTHIPVCVLGNQRDMGEHRVILPDDIRDFINSLNRPPGSSYIHYAESSMKNGFGLKY 223

  Fly   163 --------------EMAFQVIAKNALELEAEAEVIN 184
                          |...:.:..|.|:::|..|.::
Zfish   224 LHRFFNIPFLQLQRETLLRQLETNQLDIDATLEELS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 46/224 (21%)
RAB 9..174 CDD:197555 45/219 (21%)
rabl6aXP_005171795.1 P-loop_NTPase 44..222 CDD:304359 43/192 (22%)
Ras 45..222 CDD:278499 43/191 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.