DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and rab3da

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001139069.1 Gene:rab3da / 567288 ZFINID:ZDB-GENE-080722-14 Length:223 Species:Danio rerio


Alignment Length:206 Identity:67/206 - (32%)
Similarity:115/206 - (55%) Gaps:13/206 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQS 72
            :.|::|:|:|||||||.:.:|.:..|::.:.:|:|.||..|.|..|::.|.:||||||||||:::
Zfish    25 MFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVYRNEKRVKLQIWDTAGQERYRT 89

  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDNRQVSTR 137
            :..|:||||...:|:||:|..:||..:..|    ..|......|:...:::|||.||::.::..|
Zfish    90 ITTAYYRGAMGFLLMYDITNQDSFYAVQDW----ATQIKTYSWDNAQVILVGNKCDLEDDRLVAR 150

  Fly   138 RAQQWCQSKNDIPYYETSAKEGINVEMAFQ-----VIAKNALELEAEAEVINDFPDQITLGSQNN 197
            ...|...::....::|.|||:.|||:..|:     :..|....|:.:..::.   :|.....|:.
Zfish   151 EDGQRLANELGFQFFEASAKDNINVKQVFERLVDIICDKMNESLDTDPSILT---NQKGPSLQDT 212

  Fly   198 RP-GNPDNCQC 207
            .| |....|.|
Zfish   213 PPDGQSGGCGC 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 61/174 (35%)
RAB 9..174 CDD:197555 60/169 (36%)
rab3daNP_001139069.1 Rab3 25..189 CDD:206657 59/167 (35%)
RAB 26..186 CDD:197555 59/163 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.