DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and cracr2ab

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_009298523.1 Gene:cracr2ab / 564347 ZFINID:ZDB-GENE-041210-94 Length:773 Species:Danio rerio


Alignment Length:189 Identity:71/189 - (37%)
Similarity:111/189 - (58%) Gaps:11/189 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQS 72
            |.|||::|:||||||:|:.::.:.:|.:...||:|.|:..:.:.:.|..|.:|:||||||||::|
Zfish   586 LFKVILVGNSSVGKTALLRRFCDGQFHSATSATVGIDYSVRTLNLGDSHVALQLWDTAGQERYRS 650

  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVST 136
            :...|:|.||..|::||:|..:||.::..|...  ||.:..||  .|.::||||.|.:| |:|.|
Zfish   651 ITKQFFRKADGVVVIYDITMEDSFSSVRPWLSS--IQEAVGDP--IPVMLLGNKSDKENEREVQT 711

  Fly   137 RRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQ 195
            :.|....:..| :.:||.||..|.||..|...:|:...|.|....|     :.:.||.|
Zfish   712 KEADLLAEEAN-LMFYECSAYTGANVLEAMIHLARVLREQEDRVWV-----NTVRLGDQ 764

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 66/170 (39%)
RAB 9..174 CDD:197555 64/165 (39%)
cracr2abXP_009298523.1 EFh 46..106 CDD:238008
EF-hand_7 47..98 CDD:290234
FAM184 210..390 CDD:292293
RAB 587..745 CDD:197555 63/162 (39%)
Rab 587..745 CDD:206640 63/162 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.