DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and RABL6

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001167459.1 Gene:RABL6 / 55684 HGNCID:24703 Length:730 Species:Homo sapiens


Alignment Length:231 Identity:43/231 - (18%)
Similarity:90/231 - (38%) Gaps:70/231 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVV---------NDRVVTMQIWDT 64
            :|::|.||.:.|||:|.::...:.|..:|       ..|:|:.|         .|.:|.:::||.
Human    44 MKIVIRGDRNTGKTALWHRLQGRPFVEEY-------IPTQEIQVTSIHWSYKTTDDIVKVEVWDV 101

  Fly    65 AGQERFQSLG----------------------VAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFL 107
            ..:.:.:..|                      :..|:..:..|:::|:|        ..|...::
Human   102 VDKGKCKKRGDGLKMENDPQEAESEMALDAEFLDVYKNCNGVVMMFDIT--------KQWTFNYI 158

  Fly   108 IQASPRDPDHFPFVVLGNKVDL-DNRQVSTRRAQQWCQSKNDIP-------YYETSAKEGINV-- 162
            ::..|:.|.|.|..||||..|: ::|.:.....:.:..:.:..|       |.|:|.|....:  
Human   159 LRELPKVPTHVPVCVLGNYRDMGEHRVILPDDVRDFIDNLDSRPPGSSYFRYAESSMKNSFGLKY 223

  Fly   163 --------------EMAFQVIAKNALELEAEAEVIN 184
                          |...:.:..|.|:::|..|.::
Human   224 LHKFFNIPFLQLQRETLLRQLETNQLDMDATLEELS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 41/224 (18%)
RAB 9..174 CDD:197555 40/219 (18%)
RABL6NP_001167459.1 P-loop_NTPase 44..222 CDD:304359 38/192 (20%)
Ras 45..222 CDD:278499 38/191 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..730
Interaction with CDKN2A. /evidence=ECO:0000269|PubMed:16582619 656..694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.