Sequence 1: | NP_001247276.1 | Gene: | Rab7 / 42841 | FlyBaseID: | FBgn0015795 | Length: | 207 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_060287.1 | Gene: | RAB20 / 55647 | HGNCID: | 18260 | Length: | 234 | Species: | Homo sapiens |
Alignment Length: | 200 | Identity: | 60/200 - (30%) |
---|---|---|---|
Similarity: | 90/200 - (45%) | Gaps: | 49/200 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLG 74
Fly 75 VAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDNRQVSTRRA 139
Fly 140 QQWCQ-----------------------------------SKNDIP-----YYETSAKEGINVEM 164
Fly 165 AFQVI 169 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab7 | NP_001247276.1 | Rab7 | 9..179 | CDD:206655 | 60/199 (30%) |
RAB | 9..174 | CDD:197555 | 60/199 (30%) | ||
RAB20 | NP_060287.1 | Rab20 | 6..233 | CDD:133326 | 60/199 (30%) |
Effector region. /evidence=ECO:0000250 | 33..41 | 2/8 (25%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 125..144 | 1/18 (6%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 212..234 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |