DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and RAB20

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_060287.1 Gene:RAB20 / 55647 HGNCID:18260 Length:234 Species:Homo sapiens


Alignment Length:200 Identity:60/200 - (30%)
Similarity:90/200 - (45%) Gaps:49/200 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLG 74
            |:::|||.:||||||:.:|:.:||.:.. :|:|..|..|:.    |...:.||||||:|:|..||
Human     7 KIVLLGDMNVGKTSLLQRYMERRFPDTV-STVGGAFYLKQW----RSYNISIWDTAGREQFHGLG 66

  Fly    75 VAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDNRQVSTRRA 139
            ..:.|||...:|.|||....|...|:   |.||........|.. |.::||||||........:.
Human    67 SMYCRGAAAIILTYDVNHRQSLVELE---DRFLGLTDTASKDCL-FAIVGNKVDLTEEGALAGQE 127

  Fly   140 QQWCQ-----------------------------------SKNDIP-----YYETSAKEGINVEM 164
            ::.|.                                   .:.|:|     .:|||||.|.||::
Human   128 KEECSPNMDAGDRVSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCFETSAKTGYNVDL 192

  Fly   165 AFQVI 169
            .|:.:
Human   193 LFETL 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 60/199 (30%)
RAB 9..174 CDD:197555 60/199 (30%)
RAB20NP_060287.1 Rab20 6..233 CDD:133326 60/199 (30%)
Effector region. /evidence=ECO:0000250 33..41 2/8 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 125..144 1/18 (6%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..234
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.