DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and rab12

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001018466.1 Gene:rab12 / 553657 ZFINID:ZDB-GENE-050522-555 Length:235 Species:Danio rerio


Alignment Length:197 Identity:68/197 - (34%)
Similarity:113/197 - (57%) Gaps:22/197 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSL 73
            |:|||:|...|||||||.::.:..|....|:|:|.||..|.|.:..:.:.:|||||||||||.|:
Zfish    36 LQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSI 100

  Fly    74 GVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLD-NRQVSTR 137
            ..|:||||...|||||:|...:|::|..|. :.:.:.:..|.:   .:::|||:|.: :|.:|.:
Zfish   101 TSAYYRGAKGIVLVYDITKQETFEDLPKWM-KMIDKYASEDAE---LLLVGNKLDCESDRAISRQ 161

  Fly   138 RAQQWCQSKNDIPYYETSAKEGINVEMAF-----QVIAKNALE------------LEAEAEVIND 185
            :|:::....:.:.:.|.|||:..||:..|     .:::|..||            |:.|.|:..:
Zfish   162 QAERFASRISGMRFCEASAKDNFNVDEIFLKLVDDILSKMPLEVPSKELSNSVLSLQPEPEIPPE 226

  Fly   186 FP 187
            .|
Zfish   227 LP 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 65/187 (35%)
RAB 9..174 CDD:197555 62/170 (36%)
rab12NP_001018466.1 Rab12 36..235 CDD:206699 68/197 (35%)
RAB 36..200 CDD:197555 61/167 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.