DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and rab20

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_012812505.1 Gene:rab20 / 550049 XenbaseID:XB-GENE-494912 Length:272 Species:Xenopus tropicalis


Alignment Length:225 Identity:68/225 - (30%)
Similarity:104/225 - (46%) Gaps:54/225 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAG 66
            |..||..||:::|||.:||||||:::|:.:||.:.. :|:|..|..|:.    ....:.||||||
 Frog    46 SSMKKPDLKLVLLGDMNVGKTSLLHRYMERRFQDTV-STVGGAFYLKQW----GPYNISIWDTAG 105

  Fly    67 QERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN 131
            :|:|..||..:.|.|...:|.|||:...|...|:   |.||......:.|.. |.|:|||:||.:
 Frog   106 REQFHGLGSMYCRAASAVILTYDVSNMQSLLELE---DRFLGLTDTANDDCI-FAVVGNKIDLTD 166

  Fly   132 --------------------RQVST-------RRAQQW-CQSKNDIP-----YYETSAKEGINVE 163
                                :||..       :|..:: ...:|.:|     .:|||||.|.||:
 Frog   167 DYDSESDMEGERPRTSSKIRKQVDLEDAIALYKRIMKYKMLDENVVPAAEKMCFETSAKTGYNVD 231

  Fly   164 MAFQ---------VIAKNALELEAEAEVIN 184
            ..|:         ::.|.|   ....|.:|
 Frog   232 GLFEGVFNMVVPLIVKKKA---SGHDETVN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 63/211 (30%)
RAB 9..174 CDD:197555 62/206 (30%)
rab20XP_012812505.1 Rab20 53..272 CDD:133326 65/218 (30%)
Ras 54..235 CDD:278499 59/189 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.