DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and rab19

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001017246.1 Gene:rab19 / 550000 XenbaseID:XB-GENE-495128 Length:213 Species:Xenopus tropicalis


Alignment Length:208 Identity:70/208 - (33%)
Similarity:117/208 - (56%) Gaps:17/208 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQS 72
            |.|:|::|||:||||.:::::.:..|::..:.|||.||..:.:.:|.:.|.:|:|||||||||::
 Frog    15 LFKIILIGDSNVGKTCVVHRFQSGVFAHNQQNTIGVDFTVRNMNINGKKVKVQVWDTAGQERFRT 79

  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL-DNRQVST 136
            :..::||.|...::.||:|...||:::..|    :.:|......:...:::|||.|| :.||:..
 Frog    80 ITQSYYRSAHGAIIAYDITRRQSFESVPHW----IYEAEKYGAANLMMMLIGNKSDLAEKRQILF 140

  Fly   137 RRAQQWCQSKNDIPYYETSAKEGINVE-----MAFQVIAKNALELEAEAEVINDFPDQITLGSQN 196
            ..|....:....:...||||||..||:     ||.::||:|.....:|:. .|.|    .|.|:.
 Frog   141 EEACTLAEKHGLLAVLETSAKESHNVDEVFLLMAKELIARNTFHYHSESP-RNSF----MLDSKP 200

  Fly   197 -NRPGNPD-NCQC 207
             ..|..|| ||.|
 Frog   201 VLAPPEPDKNCLC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 58/175 (33%)
RAB 9..174 CDD:197555 58/170 (34%)
rab19NP_001017246.1 Rab19 13..177 CDD:133267 56/165 (34%)
Effector region. /evidence=ECO:0000250 44..52 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.