DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and rab6bb

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001013485.1 Gene:rab6bb / 541339 ZFINID:ZDB-GENE-050320-28 Length:208 Species:Danio rerio


Alignment Length:199 Identity:74/199 - (37%)
Similarity:114/199 - (57%) Gaps:6/199 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLG 74
            |::.||:.|||||||:.:::...|.|.|:||||.||.:|.:.:.||.|.:|:|||||||||:||.
Zfish    15 KLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLI 79

  Fly    75 VAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL-DNRQVSTRR 138
            .::.|.:...|:|||:|..|||:....|.|:.   .:.|..|.. .:::|||.|| :.||::...
Zfish    80 PSYIRDSTVAVVVYDITNINSFQLTSKWIDDV---RTERGSDVI-IMLVGNKTDLEEKRQITIEE 140

  Fly   139 AQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQNNRPGNPD 203
            .:|..:..| :.:.|||||.|.||:..|:.:|.....:|:..:...:....|.|..|.:.|....
Zfish   141 GEQRAKELN-VMFIETSAKTGSNVKQLFRRVAAALPGMESLDDNNKEGMIDIKLDKQPDPPATES 204

  Fly   204 NCQC 207
            .|.|
Zfish   205 GCSC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 68/169 (40%)
RAB 9..174 CDD:197555 67/164 (41%)
rab6bbNP_001013485.1 Rab6 14..174 CDD:206654 67/163 (41%)
RAB 14..171 CDD:197555 66/160 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.