DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and RAB8B

DIOPT Version :10

Sequence 1:NP_524472.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_057614.1 Gene:RAB8B / 51762 HGNCID:30273 Length:207 Species:Homo sapiens


Alignment Length:168 Identity:67/168 - (39%)
Similarity:103/168 - (61%) Gaps:6/168 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQS 72
            |.|::::|||.||||.|:.::....|:..:.:|||.||..:.:.::.:.:.:|||||||||||::
Human     8 LFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRT 72

  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL-DNRQVST 136
            :..|:||||...:||||:|...||.|:.:|.......|| .|.:.   ::||||.|: |.||||.
Human    73 ITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHAS-SDVER---MILGNKCDMNDKRQVSK 133

  Fly   137 RRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNAL 174
            .|.::...... |.:.|||||...|||.||..:|::.:
Human   134 ERGEKLAIDYG-IKFLETSAKSSANVEEAFFTLARDIM 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_524472.1 Rab7 9..179 CDD:206655 66/167 (40%)
RAB8BNP_057614.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 67/168 (40%)
Switch 1. /evidence=ECO:0000250|UniProtKB:P62820 31..45 4/13 (31%)
Switch 2. /evidence=ECO:0000250|UniProtKB:P62820 63..80 10/16 (63%)

Return to query results.
Submit another query.