DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and RAB9B

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_057454.1 Gene:RAB9B / 51209 HGNCID:14090 Length:201 Species:Homo sapiens


Alignment Length:181 Identity:99/181 - (54%)
Similarity:128/181 - (70%) Gaps:1/181 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTA 65
            ||| |..|||||:|||..|||:||||:||..:|.:|...|||.:|..:::.|:.|.||:||||||
Human     1 MSG-KSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTA 64

  Fly    66 GQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLD 130
            |||||:||...||||||||:|.:.|....||:||.:|:.||:..|..:||:||||||||||||.:
Human    65 GQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFVVLGNKVDKE 129

  Fly   131 NRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAE 181
            :|||:|..||.||....|.||.|||||:..||.:||:...:..|.:|.:.|
Human   130 DRQVTTEEAQTWCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLE 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 93/169 (55%)
RAB 9..174 CDD:197555 91/164 (55%)
RAB9BNP_057454.1 Rab9 3..172 CDD:206697 94/169 (56%)
Effector region. /evidence=ECO:0000250 36..44 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.