DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and Rab7b

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001102798.1 Gene:Rab7b / 501854 RGDID:1562617 Length:199 Species:Rattus norvegicus


Alignment Length:207 Identity:96/207 - (46%)
Similarity:135/207 - (65%) Gaps:8/207 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTA 65
            |:.|||..||:||:|...||||||::|||:|.|..:|:.|:||...:|.::::|..:.:|||||.
  Rat     1 MNPRKKVDLKLIIVGALGVGKTSLLHQYVHKTFFEEYQTTLGASILSKIIILDDTTLKLQIWDTG 65

  Fly    66 GQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLD 130
            |||||:|:...||:|:|.|:|.:|||.|.||:.||.|||:.|.:..|.: ..:|.||||||:||:
  Rat    66 GQERFRSMVSTFYKGSDGCILAFDVTDPESFEALDIWRDDVLAKIVPME-QSYPMVVLGNKIDLE 129

  Fly   131 NRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQ 195
            :|:|....|.:||:.| |:||:|.|||..|||..||:|:|..|| |..:....|...|.|.|.  
  Rat   130 DRKVPQEVAHEWCKEK-DMPYFEVSAKNDINVVQAFEVLASRAL-LRYQGIAENHLADSIKLS-- 190

  Fly   196 NNRPGNPDNCQC 207
               ||.|.:..|
  Rat   191 ---PGQPRSKCC 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 84/169 (50%)
RAB 9..174 CDD:197555 81/164 (49%)
Rab7bNP_001102798.1 Rab 9..169 CDD:206640 80/161 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172019at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47981
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.