DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and CG30158

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_652315.2 Gene:CG30158 / 50149 FlyBaseID:FBgn0050158 Length:280 Species:Drosophila melanogaster


Alignment Length:177 Identity:50/177 - (28%)
Similarity:88/177 - (49%) Gaps:20/177 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSL 73
            :::::||.:.|||:|::.:::.|.::::|:||: .|...:|..:....:.:.|.||:|..:|.::
  Fly     7 IRLVLLGGAGVGKSSIVKRFLFKTYTDKYRATV-EDLYNREYDLGGVTLKVDILDTSGDMQFPAM 70

  Fly    74 GVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL--DNRQVST 136
            .......|...:|||..|:..||:.:....:|  |:....|....|.|:.|||.||  .:|:|..
  Fly    71 RRLSIATAHAFMLVYAATSAPSFQCVKQCFEE--IREQRGDFQDIPIVIAGNKADLATTHREVKL 133

  Fly   137 RRAQQW--CQSKNDIP-----YYETSAKEGINVEMAFQVIAKNALEL 176
            .....|  |    ::|     ..|.||||..||...|    |:.|.|
  Fly   134 EEVTDWVFC----ELPRLRAKVLECSAKEDSNVTDLF----KSLLSL 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 50/177 (28%)
RAB 9..174 CDD:197555 48/173 (28%)
CG30158NP_652315.2 Ras 8..172 CDD:206642 49/174 (28%)
Ras 8..170 CDD:278499 48/172 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.