DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and si:dkey-13a21.4

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_021335282.1 Gene:si:dkey-13a21.4 / 494576 ZFINID:ZDB-GENE-040724-163 Length:229 Species:Danio rerio


Alignment Length:172 Identity:99/172 - (57%)
Similarity:129/172 - (75%) Gaps:6/172 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDR-VVTMQIWDTAGQERFQS 72
            ||:|::|:|.|||:|.|.::|:.||:|.|:||||.||.|||:.|:.| |:..|||||||.|||.|
Zfish     9 LKLILIGNSGVGKSSFMTRFVDHRFTNLYRATIGVDFLTKEITVDRRPVILQQIWDTAGTERFHS 73

  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDNRQVSTR 137
            ||.:.||||.||:||:|||:..||:.||.|:.|||:||.|.||..|||:|||||:|||:|||||.
Zfish    74 LGSSLYRGAQCCLLVFDVTSSVSFEALDVWKKEFLVQACPSDPAAFPFIVLGNKIDLDHRQVSTS 138

  Fly   138 RAQQWCQSKNDI--PYYETSAKEGINVEMAFQVIAKNALELE 177
            :||:||.   ||  .|:|:||||.|.|:..|...|:.||.|:
Zfish   139 KAQKWCV---DIGAEYFESSAKEDIGVDKTFHSAARAALHLK 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 99/172 (58%)
RAB 9..174 CDD:197555 96/167 (57%)
si:dkey-13a21.4XP_021335282.1 Rab7 9..174 CDD:206655 96/167 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172019at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47981
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.