DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and rab7a

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001008026.1 Gene:rab7a / 493388 XenbaseID:XB-GENE-483564 Length:207 Species:Xenopus tropicalis


Alignment Length:207 Identity:159/207 - (76%)
Similarity:182/207 - (87%) Gaps:0/207 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTA 65
            |:.|||.||||||||||.|||||||||||||:|:|||||||||||.||||:|:||:|||||||||
 Frog     1 MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFTNQYKATIGADFLTKEVMVDDRLVTMQIWDTA 65

  Fly    66 GQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLD 130
            |||||||||||||||||||||||||||||:||.|||||||||||||||||::||||||||||||:
 Frog    66 GQERFQSLGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKVDLE 130

  Fly   131 NRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQ 195
            ||||:|:|||.||.|||:|||:||||||.||||.|||.||:|||:.|.|.|:.|:||:.|.|...
 Frog   131 NRQVTTKRAQVWCHSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEVELYNEFPEPIKLDKN 195

  Fly   196 NNRPGNPDNCQC 207
            :....:.::|.|
 Frog   196 DRAKASAESCSC 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 145/169 (86%)
RAB 9..174 CDD:197555 142/164 (87%)
rab7aNP_001008026.1 Rab7 9..179 CDD:206655 145/169 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 300 1.000 Domainoid score I1414
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 332 1.000 Inparanoid score I2390
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172019at2759
OrthoFinder 1 1.000 - - FOG0001661
OrthoInspector 1 1.000 - - oto103588
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2001
SonicParanoid 1 1.000 - - X1058
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.