DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and zgc:101559

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001007418.1 Gene:zgc:101559 / 492776 ZFINID:ZDB-GENE-041114-122 Length:233 Species:Danio rerio


Alignment Length:200 Identity:71/200 - (35%)
Similarity:111/200 - (55%) Gaps:25/200 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQ 67
            |.:..:.|:|::|||:||||.|..::...:|.:..:||||.||..:.:.::...:.:||||||||
Zfish    31 GPQARVFKIIVIGDSNVGKTCLTYRFCGGKFLSNPEATIGVDFRERTLQLDGENIKLQIWDTAGQ 95

  Fly    68 ERF-QSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL-D 130
            ||| :|:...:||.....:.|||||:..||::|..|.:|....:.   |...|.:::|||.|| :
Zfish    96 ERFRKSMVEHYYRNVHAIIFVYDVTSLASFESLPEWIEECNHHSV---PPMVPRILVGNKCDLRE 157

  Fly   131 NRQVSTRRAQQWCQSKNDIPYYETSAK---EGINVEMAFQVIA----------------KNALEL 176
            :|:|||..||:...|.| .|.:||||:   |..:|:..|..:|                .|.::|
Zfish   158 SREVSTFLAQRLADSYN-FPLFETSARDLAEKEHVDAIFLTLAYRLKNHRPLRLKQPSESNFIQL 221

  Fly   177 EAEAE 181
            .||.|
Zfish   222 AAEQE 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 67/190 (35%)
RAB 9..174 CDD:197555 66/185 (36%)
zgc:101559NP_001007418.1 Rab33B_Rab33A 35..204 CDD:133315 65/172 (38%)
RAB 37..204 CDD:197555 65/170 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.