DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and rab11a

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001007360.1 Gene:rab11a / 492487 ZFINID:ZDB-GENE-041114-53 Length:215 Species:Danio rerio


Alignment Length:206 Identity:71/206 - (34%)
Similarity:117/206 - (56%) Gaps:11/206 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQS 72
            |.||:::|||.|||::|::::....|:.:.|:|||.:|.|:.:.|:.:.|..||||||||||:::
Zfish    11 LFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTVKAQIWDTAGQERYRA 75

  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVST 136
            :..|:||||...:||||:....:::|::.|..|....|.    .:...:::|||.||.: |.|.|
Zfish    76 ITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHAD----SNIVIMLVGNKSDLRHLRAVPT 136

  Fly   137 RRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVI----NDF-PDQITLGSQN 196
            ..|:.:.: ||.:.:.||||.:..|||.|||.|......:.::.::.    ||. |....:..|.
Zfish   137 DEARAFAE-KNGLSFLETSALDSTNVETAFQTILTEIYRIVSQKQMSDRRDNDMSPSNNVVSIQV 200

  Fly   197 NRPGNPDNCQC 207
            ....|....||
Zfish   201 QPTENKPKMQC 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 63/170 (37%)
RAB 9..174 CDD:197555 63/165 (38%)
rab11aNP_001007360.1 Rab11_like 9..173 CDD:206660 64/166 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.