DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and AgaP_AGAP011363

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_001238010.2 Gene:AgaP_AGAP011363 / 4577653 VectorBaseID:AGAP011363 Length:209 Species:Anopheles gambiae


Alignment Length:200 Identity:75/200 - (37%)
Similarity:115/200 - (57%) Gaps:7/200 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLG 74
            |::.||:.|||||||:.:::...|.|.|:||||.||.:|.:.:.||.|.:|:|||||||||:||.
Mosquito    15 KLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLI 79

  Fly    75 VAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL-DNRQVSTRR 138
            .::.|.:...|:|||:|..|||.....|.|:.   .:.|..|.. .:::|||.|| |.|||||..
Mosquito    80 PSYIRDSTVAVVVYDITNANSFHQTSKWIDDV---RTERGSDVI-IMLVGNKTDLSDKRQVSTEE 140

  Fly   139 AQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQNNRPGNPD 203
            .::..:..| :.:.|||||.|.||:..|:.:|.....:::......:...::.|....|...:|:
Mosquito   141 GERKAKELN-VMFIETSAKAGYNVKQLFRRVAAALPGMDSTENKPPEDMHEVVLKDSPNETKDPE 204

  Fly   204 -NCQC 207
             .|.|
Mosquito   205 GGCAC 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 70/169 (41%)
RAB 9..174 CDD:197555 70/164 (43%)
AgaP_AGAP011363XP_001238010.2 Rab6 14..174 CDD:206654 70/163 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.