DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and Rab18

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster


Alignment Length:201 Identity:62/201 - (30%)
Similarity:108/201 - (53%) Gaps:11/201 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSL 73
            :|::::|:|.|||:||:.::|..:|...:..|||.||.:|.:.|:.....:.:|||||.|||:||
  Fly     6 IKLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVDGIDYKVALWDTAGAERFRSL 70

  Fly    74 GVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDNRQVSTRR 138
            ..:|||.|...:||||:|:.:|...|::|..|.   .|..|..:...:|:|||:| :.|.|....
  Fly    71 TPSFYRKALGAILVYDITSRDSLVKLETWLAEL---DSYSDNPNIAIIVVGNKID-EERVVDREE 131

  Fly   139 AQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVIN--DFPDQITLGSQNNRPGN 201
            .:::.: |:...:.|||||    .:.....:.|:.:|....:|..|  :....:.:.|..:...:
  Fly   132 GRKFAR-KHRALFIETSAK----CDQFVSDVFKDVVEKIVSSEYFNNGNASAGLDIASDRDLEAS 191

  Fly   202 PDNCQC 207
            ...|.|
  Fly   192 ASTCYC 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 57/169 (34%)
RAB 9..174 CDD:197555 56/164 (34%)
Rab18NP_524744.2 RAB 6..166 CDD:197555 57/168 (34%)
Rab18 6..165 CDD:206656 57/167 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454524
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.