DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and RabX1

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster


Alignment Length:192 Identity:58/192 - (30%)
Similarity:99/192 - (51%) Gaps:10/192 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVIILGDSSVGKTSLMNQYVNKRFSNQYK--ATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQS 72
            ||::||...||||.|:.:|:......:..  .||...|.|..:::::..:.:||||||||||:::
  Fly     7 KVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAGQERYRA 71

  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLD-NRQVST 136
            :...:||.|:..:||:|:|...:|..:.||..|  :..:.:||  ....::|||:|:. .|.||.
  Fly    72 VAPMYYRNANAAILVFDLTQYKTFTEIKSWIQE--LHRNVQDP--MILTLVGNKMDMQAQRAVSR 132

  Fly   137 RRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALEL--EAEAEVINDFPDQITLGSQN 196
            ..|..:..|.. ..|:|||.:....:|..|...|:..:.|  |.::..:..|....:|...|
  Fly   133 EEAFVFATSIG-ATYFETSTETDQGLEQVFISTAQGLVRLADEGKSPSLRSFQSTDSLAYTN 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 55/173 (32%)
RAB 9..174 CDD:197555 53/166 (32%)
RabX1NP_524713.1 Ras 7..166 CDD:278499 52/163 (32%)
Rab 7..166 CDD:206640 52/163 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454448
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.