Sequence 1: | NP_001247276.1 | Gene: | Rab7 / 42841 | FlyBaseID: | FBgn0015795 | Length: | 207 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002591.1 | Gene: | rnd3b / 436864 | ZFINID: | ZDB-GENE-040718-331 | Length: | 223 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 52/196 - (26%) |
---|---|---|---|
Similarity: | 94/196 - (47%) | Gaps: | 27/196 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 KVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSLG 74
Fly 75 VAFYRGADCCVLVYDVTAPNSFKN-LDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDNRQVSTRR 138
Fly 139 AQ--QWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAE--AEVINDFPDQITLG--SQNN 197
Fly 198 R 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab7 | NP_001247276.1 | Rab7 | 9..179 | CDD:206655 | 45/171 (26%) |
RAB | 9..174 | CDD:197555 | 44/166 (27%) | ||
rnd3b | NP_001002591.1 | P-loop_NTPase | 4..182 | CDD:304359 | 49/191 (26%) |
RHO | 11..182 | CDD:197554 | 48/190 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |