DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and rab7b

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001002178.1 Gene:rab7b / 431725 ZFINID:ZDB-GENE-180906-1 Length:204 Species:Danio rerio


Alignment Length:208 Identity:162/208 - (77%)
Similarity:181/208 - (87%) Gaps:5/208 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTA 65
            |:.|||.||||||||||.||||||||||||.:|||||||||||||.||||:|:||:|||||||||
Zfish     1 MASRKKVLLKVIILGDSGVGKTSLMNQYVNNKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTA 65

  Fly    66 GQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLD 130
            ||||||||||||||||||||||||||||.:||.|||||||||||||..||::|||||||||:|||
Zfish    66 GQERFQSLGVAFYRGADCCVLVYDVTAPTTFKTLDSWRDEFLIQASTSDPENFPFVVLGNKIDLD 130

  Fly   131 NRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQ 195
            ||||||:|||.||||||:|||:||||||.||||.|||.||:|||:.|:..:.  ||||:|.||  
Zfish   131 NRQVSTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQESVDKY--DFPDEIKLG-- 191

  Fly   196 NNRP-GNPDNCQC 207
            |:|| .|.:.|.|
Zfish   192 NDRPMSNGEGCSC 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 144/169 (85%)
RAB 9..174 CDD:197555 141/164 (86%)
rab7bNP_001002178.1 Rab7 9..178 CDD:206655 143/168 (85%)
RAB 9..176 CDD:197555 143/166 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592696
Domainoid 1 1.000 302 1.000 Domainoid score I1369
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H100564
Inparanoid 1 1.050 334 1.000 Inparanoid score I2393
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172019at2759
OrthoFinder 1 1.000 - - FOG0001661
OrthoInspector 1 1.000 - - otm25790
orthoMCL 1 0.900 - - OOG6_101358
Panther 1 1.100 - - O PTHR47981
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1058
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.