DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and Rab23

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_649574.1 Gene:Rab23 / 40701 FlyBaseID:FBgn0037364 Length:268 Species:Drosophila melanogaster


Alignment Length:194 Identity:62/194 - (31%)
Similarity:99/194 - (51%) Gaps:12/194 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSL 73
            :||:|:|:..|||:|::.:|....|:..||.|||.||..:::.::...|.:.:|||||||.|..:
  Fly    38 IKVVIVGNGGVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIEIDGEDVRIMLWDTAGQEEFDCI 102

  Fly    74 GVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDNRQVSTRR 138
            ..|:||||...|||:..|...||..:..|:     :....:.:..|.|::.||:||..:.|.|..
  Fly   103 TKAYYRGAQASVLVFSTTDRASFDAIKDWK-----RKVENECNEIPTVIVQNKIDLIEQAVVTAD 162

  Fly   139 AQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQNNRPGNP 202
            ..:......:.....||.||.|||...|:.:|....:|..::.      ||:. |:|.|....|
  Fly   163 EVETLAKLLNCRLIRTSVKEDINVASVFRYLATKCHQLMTQSY------DQVA-GNQQNSSHPP 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 56/169 (33%)
RAB 9..174 CDD:197555 55/164 (34%)
Rab23NP_649574.1 Ras 50..199 CDD:278499 49/153 (32%)
Rab23_like 50..197 CDD:133306 49/151 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454415
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.