DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and Rab26

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster


Alignment Length:165 Identity:70/165 - (42%)
Similarity:102/165 - (61%) Gaps:8/165 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVIILGDSSVGKTSLMNQYVNKRFSNQY-KATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSL 73
            |||:||||.||||||:.::.:.|:...| .:|:|.||..|.|||:...|.:|||||||||||:|:
  Fly   214 KVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRVKLQIWDTAGQERFRSV 278

  Fly    74 GVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL--DNRQVST 136
            ..|:||.|...:|:||||...::.|:.:|..|....|.    :....|::|||.|.  ..|||..
  Fly   279 THAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQ----EDVVIVLIGNKADCSGSERQVKR 339

  Fly   137 RRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAK 171
            ...::..:..| :|:.|||||.|:|||::|..:|:
  Fly   340 EDGERLGREHN-VPFMETSAKTGLNVELSFTAVAR 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 70/165 (42%)
RAB 9..174 CDD:197555 70/165 (42%)
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 70/165 (42%)
RAB 214..378 CDD:197555 70/165 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454463
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.