DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and MGC75872

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_989167.1 Gene:MGC75872 / 394774 XenbaseID:XB-GENE-5919586 Length:199 Species:Xenopus tropicalis


Alignment Length:205 Identity:112/205 - (54%)
Similarity:141/205 - (68%) Gaps:18/205 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSL 73
            ||::::|::..||::|||||||.||:|.|:|||||||.|||:.|||:|||:|||||||.||||||
 Frog     7 LKLLLIGNAGSGKSALMNQYVNCRFTNYYRATIGADFFTKELRVNDKVVTVQIWDTAGTERFQSL 71

  Fly    74 GVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDNRQVSTRR 138
            |.|.|||.|||:||:|||:||||..||:|..|||:||.|..|..|||||:|||.||:.||||.|.
 Frog    72 GAALYRGTDCCLLVFDVTSPNSFHALDNWHREFLVQADPVSPGSFPFVVIGNKTDLEERQVSLRE 136

  Fly   139 AQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNAL------ELEAEAEVINDFPDQITLGSQNN 197
            |::||::.| ..|:||||||..||:.||....|.|.      :...|.:|:|..|          
 Frog   137 AEEWCKTYN-AKYFETSAKESRNVDEAFLEAIKLAFNNHQEPDQNWETKVVNLSP---------- 190

  Fly   198 RPGNPDNCQC 207
             |.|...|.|
 Frog   191 -PSNSKKCDC 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 104/175 (59%)
RAB 9..174 CDD:197555 103/164 (63%)
MGC75872NP_989167.1 Rab7 7..176 CDD:206655 104/169 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172019at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.