DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and rab7a

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_957222.1 Gene:rab7a / 393902 ZFINID:ZDB-GENE-040426-1352 Length:207 Species:Danio rerio


Alignment Length:207 Identity:159/207 - (76%)
Similarity:182/207 - (87%) Gaps:0/207 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTA 65
            |:.|||.||||||||||.|||||||||||||:|||||||||||||.||||:|:||:|||||||||
Zfish     1 MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTA 65

  Fly    66 GQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLD 130
            ||||||||||||||||||||||:||||||:||.|||||||||||||||||::|||||||||:||:
Zfish    66 GQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLE 130

  Fly   131 NRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQ 195
            ||||:|:|||.||||||:|||:||||||.||||.|||.||:|||:.|.|.|:.|:||:.|.|...
Zfish   131 NRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEVELYNEFPEPIKLDRN 195

  Fly   196 NNRPGNPDNCQC 207
            :....:.:.|.|
Zfish   196 DRAKPSAETCSC 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 145/169 (86%)
RAB 9..174 CDD:197555 142/164 (87%)
rab7aNP_957222.1 Rab7 9..179 CDD:206655 145/169 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592695
Domainoid 1 1.000 302 1.000 Domainoid score I1369
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 334 1.000 Inparanoid score I2393
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172019at2759
OrthoFinder 1 1.000 - - FOG0001661
OrthoInspector 1 1.000 - - otm25790
orthoMCL 1 0.900 - - OOG6_101358
Panther 1 1.100 - - LDO PTHR47981
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2001
SonicParanoid 1 1.000 - - X1058
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.