DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and CG8641

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001261494.1 Gene:CG8641 / 38771 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster


Alignment Length:172 Identity:40/172 - (23%)
Similarity:78/172 - (45%) Gaps:12/172 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERF 70
            |:..::::||.|..||:|::.:::..||...|..|| .:|..|...:.:.|..:.|.||:|...|
  Fly   164 KNCYRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTI-EEFHRKLYRIRNEVFQLDILDTSGYHPF 227

  Fly    71 QSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFL----IQASP------RDPDHFPFVVLGN 125
            .::....:...|..:||:.:.:..||:.:...|:..|    ...:|      :.....|.::.||
  Fly   228 PAMRRLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPMILAGN 292

  Fly   126 KVDLDNRQVSTRRAQQWCQSK-NDIPYYETSAKEGINVEMAF 166
            |.|.|.:.|.......:...: |...:.|.||::...::..|
  Fly   293 KCDRDFKTVQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLF 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 39/169 (23%)
RAB 9..174 CDD:197555 39/169 (23%)
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 39/169 (23%)
RAS 167..338 CDD:214541 39/169 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.