DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and rab11al

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_956417.1 Gene:rab11al / 386994 ZFINID:ZDB-GENE-031118-188 Length:216 Species:Danio rerio


Alignment Length:199 Identity:67/199 - (33%)
Similarity:116/199 - (58%) Gaps:9/199 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRKKS---LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIW 62
            |:||:..   |.||:::|||.|||::|::::....|:.:.|:|||.:|.|:.:.|..:.|..|||
Zfish     1 MTGREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIHVEGKTVKAQIW 65

  Fly    63 DTAGQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKV 127
            |||||||::::..|:||||...:||||:....:::|.:.|..|....|.    .:...:::|||.
Zfish    66 DTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENAERWLKELQDHAD----SNIVIMLVGNKS 126

  Fly   128 DLDN-RQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQIT 191
            ||.: |.|....|:.:.: |:.:.:.||||.:..|||:|||.|......:.::.::.....|..:
Zfish   127 DLRHLRAVPMDEAKAFAE-KHGLSFLETSALDSSNVELAFQTILTEIYRIVSQRQMSGRGDDSFS 190

  Fly   192 LGSQ 195
            ..|:
Zfish   191 PSSK 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 61/170 (36%)
RAB 9..174 CDD:197555 61/165 (37%)
rab11alNP_956417.1 PLN03110 1..215 CDD:178657 67/199 (34%)
Rab11_like 9..173 CDD:206660 62/168 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.