DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and rab32a

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_958489.1 Gene:rab32a / 378969 ZFINID:ZDB-GENE-031006-10 Length:213 Species:Danio rerio


Alignment Length:223 Identity:70/223 - (31%)
Similarity:115/223 - (51%) Gaps:42/223 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVN---DRVVTMQIWDTAG 66
            |:.|.||:::|:..|||||::.:||::.||..|:||||.||..|  |:|   ..:|.:|:||.||
Zfish    10 KEYLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALK--VLNWDSKTLVRLQLWDIAG 72

  Fly    67 QERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVD--- 128
            ||||.::...:|:.|....:|:|:|..::|:.:..|:.:...:....:.:..|.|:|.||.|   
Zfish    73 QERFGNMTRVYYKEAVGAFIVFDITRGSTFEAVSKWKHDLDTKVKLANGNPIPSVLLANKCDQKK 137

  Fly   129 --------LDNRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVIND 185
                    :||          :|:....:.::||||||.|||:.|.:.:.:|.|        :||
Zfish   138 DGSNNSSLMDN----------FCKEAGFLGWFETSAKENINVDEAARFLVENIL--------LND 184

  Fly   186 --FP------DQITLGSQNNRPGNPDNC 205
              .|      |:|.|..|.....:...|
Zfish   185 KGLPYEENNGDKIKLDHQTALAESKSGC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 60/183 (33%)
RAB 9..174 CDD:197555 59/178 (33%)
rab32aNP_958489.1 Rab32_Rab38 14..213 CDD:206692 68/219 (31%)
RAB 14..183 CDD:197555 60/188 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.