DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and Rab32

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001102372.1 Gene:Rab32 / 365042 RGDID:1559997 Length:223 Species:Rattus norvegicus


Alignment Length:217 Identity:71/217 - (32%)
Similarity:118/217 - (54%) Gaps:28/217 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDR-VVTMQIWDTAGQE 68
            ::.|.||:::|:..|||||::.:||::.||..|:||||.||..|.:..:.| :|.:|:||.||||
  Rat    20 REHLFKVLVIGELGVGKTSIIKRYVHQLFSQNYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQE 84

  Fly    69 RFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEF-----LIQASPRDPDHFPFVVLGNKVD 128
            ||.::...:|:.|....:|:|::..::|..:..|:::.     |...||     .|.|:|.||.|
  Rat    85 RFGNMTRVYYKEALGAFVVFDISRSSTFDAVLKWKNDLDSKVHLPNGSP-----IPAVLLANKCD 144

  Fly   129 --LDNRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFP---- 187
              .|:.| |..:..|:|:....|.::|||||:.||::.|.:.:.:|.|..:      ..||    
  Rat   145 QKKDSSQ-SPSQMNQFCKDHGFIGWFETSAKDNINIDEATRFLVENMLANQ------QSFPREEI 202

  Fly   188 --DQITLGSQNNRPGNPDNCQC 207
              |:|.|..:  .|......||
  Rat   203 DMDKIKLVEE--PPTTKPKSQC 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 62/177 (35%)
RAB 9..174 CDD:197555 61/172 (35%)
Rab32NP_001102372.1 Rab32_Rab38 24..222 CDD:206692 68/211 (32%)
RAB 24..193 CDD:197555 62/174 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.