DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and Rabl2

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_006242287.1 Gene:Rabl2 / 362987 RGDID:1306749 Length:250 Species:Rattus norvegicus


Alignment Length:188 Identity:59/188 - (31%)
Similarity:100/188 - (53%) Gaps:11/188 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQSL 73
            :|:|.||||:|||:.||.:::...|..|..:|...........|:.:.:.:..|||||||||||:
  Rat    49 VKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGKTILVDFWDTAGQERFQSM 113

  Fly    74 GVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDNRQVSTRR 138
            ..::|..|..|::|:||....::|||.:|..| |.:..|    ..|.:::.||:|.|.:.  |::
  Rat   114 HASYYHKAHACIMVFDVQRKITYKNLGTWYAE-LREFRP----EIPCILVANKIDADIQM--TQK 171

  Fly   139 AQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEAEVINDFPDQITLGSQN 196
            ...:.: |..:|.|..||.:|.||...|....:.|:..:..::   ||.|::....:|
  Rat   172 NFSFAK-KFSLPLYFVSAADGTNVVKLFNDAIRLAVAYKKSSQ---DFMDEVLQELEN 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 55/169 (33%)
RAB 9..174 CDD:197555 54/164 (33%)
Rabl2XP_006242287.1 RabL2 49..209 CDD:133324 55/167 (33%)
RAB 49..198 CDD:197555 53/156 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.