DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and Rabl6

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001102043.1 Gene:Rabl6 / 362084 RGDID:1307615 Length:731 Species:Rattus norvegicus


Alignment Length:230 Identity:45/230 - (19%)
Similarity:91/230 - (39%) Gaps:69/230 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVV---------NDRVVTMQIWDT 64
            :|::|.||.:.|||:|.::...|:|..:|       ..|:|:.|         .|.||.:::||.
  Rat    44 MKIVIRGDRNTGKTALWHRLQGKKFVEEY-------IPTQEIQVTSIHWNYKTTDDVVKVEVWDV 101

  Fly    65 AGQERFQSLG----------------------VAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFL 107
            ..:.:.:..|                      :..|:..:..|:::|:|        ..|...::
  Rat   102 VDKGKCKKRGDCLKTENDPQEAESEMALDAEFLDVYKNCNGVVMMFDIT--------KQWTFNYV 158

  Fly   108 IQASPRDPDHFPFVVLGNKVDL-DNRQVSTRRAQQWCQSKNDIP------YYETSAKEGINV--- 162
            ::..|:.|.|.|..||||..|: ::|.:.....:.:.:..:..|      |.|:|.|....:   
  Rat   159 LRELPKVPTHVPVCVLGNYRDMGEHRVILPDDVRDFIEHLDRPPGSSYFRYAESSMKNSFGLKYL 223

  Fly   163 -------------EMAFQVIAKNALELEAEAEVIN 184
                         |...:.:..|.|:::|..|.::
  Rat   224 HKFFNIPFLQLQRETLLRQLETNQLDIDATLEELS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 43/223 (19%)
RAB 9..174 CDD:197555 42/218 (19%)
Rabl6NP_001102043.1 P-loop_NTPase 44..221 CDD:304359 40/191 (21%)
Ras 45..221 CDD:278499 40/190 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.