DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and Rab3

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster


Alignment Length:212 Identity:74/212 - (34%)
Similarity:121/212 - (57%) Gaps:24/212 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQS 72
            :.|::|:|:|||||||.:.:|.:..|::.:.:|:|.||..|.|..:|:.|.:||||||||||:::
  Fly    21 MFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRT 85

  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL-DNRQVST 136
            :..|:||||...:|:||||..:||.::..|    :.|......|:...:::|||.|: |.|.:|.
  Fly    86 ITTAYYRGAMGFILMYDVTNEDSFNSVQDW----VTQIKTYSWDNAQVILVGNKCDMEDQRVISF 146

  Fly   137 RRAQQWCQSKNDIPYYETSAKEGINVEMAFQ-----VIAKNALELEAEAEVINDFPDQITLGSQN 196
            .|.:|...... :.::||||||.:||:..|:     :..|.:..|:|:       |..:..|.:.
  Fly   147 ERGRQLADQLG-VEFFETSAKENVNVKAVFERLVDIICDKMSESLDAD-------PTLVGGGQKG 203

  Fly   197 NR-----PGNPD-NCQC 207
            .|     .|.|: ||.|
  Fly   204 QRLTDQPQGTPNANCNC 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 65/175 (37%)
RAB 9..174 CDD:197555 64/170 (38%)
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 63/168 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454264
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.