DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and Rab9

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster


Alignment Length:200 Identity:88/200 - (44%)
Similarity:119/200 - (59%) Gaps:10/200 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQE 68
            :|..||||:||||..|||::|:.::|..|:......|||.:|..|::||:....|:|||||||||
  Fly     8 QKSKLLKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIWDTAGQE 72

  Fly    69 RFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL--DN 131
            ||::|...||||:|.|:|.|.:...:|.|.|..||:|||..|.. |.|.|||:|:|||.|:  ..
  Fly    73 RFRALRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADV-DQDKFPFIVVGNKNDIPAQK 136

  Fly   132 RQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAK--NALELEAEAEVINDFPDQITLGS 194
            ||||:...||||..:....:.|||:|...||..||.:..:  ..:|..|||| :....|.|.|  
  Fly   137 RQVSSDAVQQWCAEQKVACHIETSSKAATNVTDAFVLGLRQWRHMECVAEAE-LRQHGDTIDL-- 198

  Fly   195 QNNRP 199
              .||
  Fly   199 --TRP 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 77/173 (45%)
RAB 9..174 CDD:197555 76/168 (45%)
Rab9NP_609966.1 Rab9 8..178 CDD:206697 78/170 (46%)
Ras 14..177 CDD:278499 75/163 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454528
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0394
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S534
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101401at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47981
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.