DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and Rab14

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_788056.1 Gene:Rab14 / 34840 FlyBaseID:FBgn0015791 Length:239 Species:Drosophila melanogaster


Alignment Length:210 Identity:73/210 - (34%)
Similarity:119/210 - (56%) Gaps:15/210 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERFQS 72
            :.|.||:||..|||:.|::|:..|:|......|||.:|.|:.:.|:|:.:.:|||||||||||::
  Fly    35 IFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRA 99

  Fly    73 LGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDN-RQVST 136
            :..::||||...::|||:|..:::.:|.||..:   ..:..:|....|:: |||.||:: |:|:.
  Fly   100 VTRSYYRGAAGALMVYDITRRSTYNHLSSWLTD---TRNLTNPSTVIFLI-GNKSDLESTREVTY 160

  Fly   137 RRAQQWCQSKNDIPYYETSAKEGINVEMAF--------QVIAKNALELEAEAEVINDFPDQITLG 193
            ..|:::. .:|.:.:.|.||..|.|||.||        |.|.:..|:|.|....:...|.|.:..
  Fly   161 EEAKEFA-DENGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRLDLNASESGVQHRPSQPSRT 224

  Fly   194 S-QNNRPGNPDNCQC 207
            | .:...|..|.|.|
  Fly   225 SLSSEATGAKDQCSC 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 65/178 (37%)
RAB 9..174 CDD:197555 63/173 (36%)
Rab14NP_788056.1 Rab14 34..199 CDD:133322 61/168 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454432
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.