DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and Rab30

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001245926.1 Gene:Rab30 / 33988 FlyBaseID:FBgn0031882 Length:223 Species:Drosophila melanogaster


Alignment Length:165 Identity:63/165 - (38%)
Similarity:99/165 - (60%) Gaps:5/165 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTAGQERF 70
            |.|.|::::|::.||||.|:.::....|.....||||.||..|.|.|....:.:|||||||||||
  Fly     5 KFLFKIVLVGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVEGEKIKLQIWDTAGQERF 69

  Fly    71 QSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLDNRQVS 135
            :|:..::||.|...:||||::...:|..|..|..|....|:.:    ...:::|||.|.|:|::.
  Fly    70 RSITQSYYRSAHALILVYDISCQPTFDCLPDWLREIQEYANSK----VLKILVGNKTDRDDREIP 130

  Fly   136 TRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIA 170
            |:..:::.: ::|:.:.||||||..|||..|..||
  Fly   131 TQIGEEFAK-QHDMYFLETSAKEAENVERLFYEIA 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 61/162 (38%)
RAB 9..174 CDD:197555 61/162 (38%)
Rab30NP_001245926.1 Rab30 1..168 CDD:133314 63/165 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454531
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.