DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab7 and RAB7B

DIOPT Version :9

Sequence 1:NP_001247276.1 Gene:Rab7 / 42841 FlyBaseID:FBgn0015795 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001157994.1 Gene:RAB7B / 338382 HGNCID:30513 Length:199 Species:Homo sapiens


Alignment Length:195 Identity:92/195 - (47%)
Similarity:127/195 - (65%) Gaps:8/195 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQIWDTA 65
            |:.|||..||:||:|...||||||::|||:|.|..:|:.|:||...:|.:::.|..:.:|||||.
Human     1 MNPRKKVDLKLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQIWDTG 65

  Fly    66 GQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDLD 130
            |||||:|:...||:|:|.|:|.:|||...||:.||.||.:.|.:..|.: ..:|.|:||||:||.
Human    66 GQERFRSMVSTFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPME-QSYPMVLLGNKIDLA 129

  Fly   131 NRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALE-----LEAE-AEVINDFPDQ 189
            :|:|....||.||:.| ||||:|.|||..|||..||:::|..||.     ||.. .|.|...|||
Human   130 DRKVPQEVAQGWCREK-DIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQ 193

  Fly   190  189
            Human   194  193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab7NP_001247276.1 Rab7 9..179 CDD:206655 83/174 (48%)
RAB 9..174 CDD:197555 79/164 (48%)
RAB7BNP_001157994.1 Rab 9..169 CDD:206640 78/161 (48%)
Effector region. /evidence=ECO:0000250 37..45 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0394
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172019at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47981
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.